GBX1 Antikörper (Middle Region)

Produktnummer ABIN632458

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch GBX1 in WB. Er zeigt eine Reaktivität gegenüber Maus, Ratte, Human und Drosophila melanogaster.

Kurzübersicht für GBX1 Antikörper (Middle Region) (ABIN632458)

Target: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Reaktivität: Maus, Ratte, Human, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GBX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GBX1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GBX1 antibody was raised against the middle region of Gbx-1

Aufreinigung: Affinity purified

Immunogen: GBX1 antibody was raised using the middle region of Gbx-1 corresponding to a region with amino acids AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GBX1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this GBX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBX-1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GBX1

Target: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Andere Bezeichnung: GBX1

Hintergrund: GBX-1 contains 1 homeobox DNA-binding domain. The exact functions of GBX-1 remain unknown.

Molekulargewicht: 40 kDa (MW of target protein)