Destrin Antikörper
-
- Target Alle Destrin (DSTN) Antikörper anzeigen
- Destrin (DSTN) (Destrin (Actin Depolymerizing Factor) (DSTN))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Destrin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Destrin antibody was raised using a synthetic peptide corresponding to a region with amino acids ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE
- Top Product
- Discover our top product DSTN Primärantikörper
-
anti-Destrin (Actin Depolymerizing Factor) (DSTN) antibody
DSTN Reaktivität: Human, Affe, Hund WB, IHC, FACS, IHC (p), IF Wirt: Maus Monoclonal 2F7 unconjugated
anti-Destrin (Actin Depolymerizing Factor) (DSTN) antibodyDSTN Reaktivität: Human, Affe, Hund WB, IHC, FACS, IHC (p), IF Wirt: Maus Monoclonal 1D8 unconjugated
anti-Destrin (Actin Depolymerizing Factor) (DSTN) (AA 70-98) antibodyDSTN Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB23763 unconjugated
anti-Destrin (Actin Depolymerizing Factor) (DSTN) (AA 77-106), (Middle Region) antibodyDSTN Reaktivität: Human WB, FACS, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Destrin (Actin Depolymerizing Factor) (DSTN) (AA 2-165) antibodyDSTN Reaktivität: Human IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Destrin (Actin Depolymerizing Factor) (DSTN) antibodyDSTN Reaktivität: Human, Ratte, Maus IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Destrin (Actin Depolymerizing Factor) (DSTN) (AA 56-164) antibodyDSTN Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Destrin (Actin Depolymerizing Factor) (DSTN) antibodyDSTN Reaktivität: Human WB Wirt: Kaninchen Monoclonal unconjugated
anti-Destrin (Actin Depolymerizing Factor) (DSTN) (N-Term) antibodyDSTN Reaktivität: Human, Ratte, Maus, Affe, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Fledermaus, Huhn, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Destrin (Actin Depolymerizing Factor) (DSTN) (AA 1-165) antibodyDSTN Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Destrin Blocking Peptide, catalog no. 33R-1510, is also available for use as a blocking control in assays to test for specificity of this Destrin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSTN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Destrin (DSTN) (Destrin (Actin Depolymerizing Factor) (DSTN))
- Andere Bezeichnung
- Destrin (DSTN Produkte)
- Hintergrund
- DSTN belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. It is the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin).
- Molekulargewicht
- 18 kDa (MW of target protein)
-
