Destrin Antikörper

Produktnummer ABIN632457

Dieser Anti-Destrin-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von Destrin in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für Destrin Antikörper (ABIN632457)

Target: Destrin (DSTN) (Destrin (Actin Depolymerizing Factor) (DSTN))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Destrin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Destrin Antikörper

Aufreinigung: Affinity purified

Immunogen: Destrin antibody was raised using a synthetic peptide corresponding to a region with amino acids ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Destrin Blocking Peptide, (ABIN936896), is also available for use as a blocking control in assays to test for specificity of this Destrin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSTN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Destrin

Target: Destrin (DSTN) (Destrin (Actin Depolymerizing Factor) (DSTN))

Andere Bezeichnung: Destrin

Hintergrund: DSTN belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. It is the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin).

Molekulargewicht: 18 kDa (MW of target protein)