AHCYL1 Antikörper (N-Term)

Produktnummer ABIN632455

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch AHCYL1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für AHCYL1 Antikörper (N-Term) (ABIN632455)

Target: AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AHCYL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AHCYL1 Antikörper

Bindungsspezifität: N-Term

Spezifität: AHCYL1 antibody was raised against the N terminal of AHCYL1

Aufreinigung: Affinity purified

Immunogen: AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AHCYL1 Blocking Peptide, (ABIN5611979), is also available for use as a blocking control in assays to test for specificity of this AHCYL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCYL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AHCYL1

Target: AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))

Andere Bezeichnung: AHCYL1

Hintergrund: The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).

Molekulargewicht: 59 kDa (MW of target protein)