EIF5A2 Antikörper (N-Term)

Produktnummer ABIN632450

Produktdetails anti-EIF5A2 Antikörper

Target: EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF5A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF5 A2 antibody was raised against the N terminal of EIF5 2

Aufreinigung: Affinity purified

Immunogen: EIF5 A2 antibody was raised using the N terminal of EIF5 2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF5A2 Blocking Peptide, catalog no. 33R-5619, is also available for use as a blocking control in assays to test for specificity of this EIF5A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF5A2

Target: EIF5A2 (Eukaryotic Translation Initiation Factor 5A2 (EIF5A2))

Andere Bezeichnung: EIF5A2 (EIF5A2 Produkte)

Synonyme: EIF5A2 antikoerper, EIF5A antikoerper, zgc:55504 antikoerper, zgc:77429 antikoerper, wu:fb05b06 antikoerper, wu:fc23f04 antikoerper, wu:fc61c10 antikoerper, EIF-5A2 antikoerper, eIF5AII antikoerper, 9630038B20 antikoerper, eukaryotic translation initiation factor 5A2 antikoerper, eukaryotic translation initiation factor 5A3 antikoerper, EIF5A2 antikoerper, eif5a2 antikoerper, LOC100499632 antikoerper, Eif5a2 antikoerper

Hintergrund: EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.

Molekulargewicht: 17 kDa (MW of target protein)