FAM83E Antikörper (Middle Region)

Produktnummer ABIN632448

Produktdetails anti-FAM83E Antikörper

Target: FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM83E Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM83 E antibody was raised against the middle region of FAM83

Aufreinigung: Affinity purified

Immunogen: FAM83 E antibody was raised using the middle region of FAM83 corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM83E Blocking Peptide, catalog no. 33R-7823, is also available for use as a blocking control in assays to test for specificity of this FAM83E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM83E

Target: FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))

Andere Bezeichnung: FAM83E (FAM83E Produkte)

Synonyme: 4930403C10Rik antikoerper, family with sequence similarity 83 member E antikoerper, family with sequence similarity 83, member E antikoerper, FAM83E antikoerper, Fam83e antikoerper

Hintergrund: The function of FAM83 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 52 kDa (MW of target protein)