FAM83E Antikörper (Middle Region)
-
- Target Alle FAM83E Produkte
- FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM83E Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM83 E antibody was raised against the middle region of FAM83
- Aufreinigung
- Affinity purified
- Immunogen
- FAM83 E antibody was raised using the middle region of FAM83 corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM
-
anti-Family with Sequence Similarity 83, Member E (FAM83E) (AA 359-408) antibody
FAM83E Reaktivität: Human, Meerschweinchen, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Family with Sequence Similarity 83, Member E (FAM83E) (Middle Region) antibodyFAM83E Reaktivität: Maus, Human, Meerschweinchen, Ratte, Rind (Kuh), Hund, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM83E Blocking Peptide, catalog no. 33R-7823, is also available for use as a blocking control in assays to test for specificity of this FAM83E antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))
- Andere Bezeichnung
- FAM83E (FAM83E Produkte)
- Hintergrund
- The function of FAM83 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 52 kDa (MW of target protein)
-
