BEND7 Antikörper (N-Term)

Produktnummer ABIN632443

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch BEND7 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für BEND7 Antikörper (N-Term) (ABIN632443)

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BEND7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BEND7 Antikörper

Bindungsspezifität: N-Term

Spezifität: C10 orf30 antibody was raised against the N terminal of C10 rf30

Aufreinigung: Affinity purified

Immunogen: C10 orf30 antibody was raised using the N terminal of C10 rf30 corresponding to a region with amino acids AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C10orf30 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this C10orf30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BEND7

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Andere Bezeichnung: C10orf30

Hintergrund: The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 51 kDa (MW of target protein)