GTPBP2 Antikörper (N-Term)

Produktnummer ABIN632438

Der Kaninchen Polyklonal Anti-GTPBP2-Antikörper wurde für WB validiert. Er ist geeignet, GTPBP2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für GTPBP2 Antikörper (N-Term) (ABIN632438)

Target: GTPBP2 (GTP Binding Protein 2 (GTPBP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GTPBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GTPBP2 Antikörper

Bindungsspezifität: N-Term

Spezifität: GTPBP2 antibody was raised against the N terminal of GTPBP2

Aufreinigung: Affinity purified

Immunogen: GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GTPBP2 Blocking Peptide, (ABIN938571), is also available for use as a blocking control in assays to test for specificity of this GTPBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GTPBP2

Target: GTPBP2 (GTP Binding Protein 2 (GTPBP2))

Andere Bezeichnung: GTPBP2

Hintergrund: GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.

Molekulargewicht: 66 kDa (MW of target protein)