Exophilin 5 Antikörper (Middle Region)

Produktnummer ABIN632437

Produktdetails anti-Exophilin 5 Antikörper

Target: Exophilin 5 (EXPH5)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Exophilin 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EXPH5 antibody was raised against the middle region of EXPH5

Aufreinigung: Affinity purified

Immunogen: EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXPH5 Blocking Peptide, catalog no. 33R-7572, is also available for use as a blocking control in assays to test for specificity of this EXPH5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXPH5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Exophilin 5

Target: Exophilin 5 (EXPH5)

Andere Bezeichnung: EXPH5 (EXPH5 Produkte)

Synonyme: RGD1560308 antikoerper, AC079869.22gm5 antikoerper, B130009M24Rik antikoerper, E030050P12 antikoerper, Kiaa0624 antikoerper, Slac2b antikoerper, slac2-b antikoerper, DKFZp469K2410 antikoerper, SLAC2-B antikoerper, SLAC2B antikoerper, exophilin 5 antikoerper, Exph5 antikoerper, EXPH5 antikoerper

Hintergrund: EXPH5 may act as a Rab effector protein and play a role in vesicle trafficking.

Molekulargewicht: 222 kDa (MW of target protein)