COBLL1 Antikörper (N-Term)

Produktnummer ABIN632436

Dieses Anti-COBLL1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von COBLL1 in WB und IHC. Geeignet für Human, Hund, Maus und Ratte.

Kurzübersicht für COBLL1 Antikörper (N-Term) (ABIN632436)

Target: COBLL1 (COBL-Like 1 (COBLL1))

Reaktivität: Human, Hund, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COBLL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-COBLL1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Cobl-Like 1 antibody was raised against the N terminal of COBLL1

Aufreinigung: Affinity purified

Immunogen: Cobl-Like 1 antibody was raised using the N terminal of COBLL1 corresponding to a region with amino acids SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cobl-Like 1 Blocking Peptide, (ABIN5612946), is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COBLL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COBLL1

Target: COBLL1 (COBL-Like 1 (COBLL1))

Andere Bezeichnung: Cobl-Like 1

Hintergrund: The function of this gene remains unknown.

Molekulargewicht: 128 kDa (MW of target protein)