LRP2BP Antikörper (Middle Region)

Produktnummer ABIN632431

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LRP2BP in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte, Hund und Maus.

Kurzübersicht für LRP2BP Antikörper (Middle Region) (ABIN632431)

Target: LRP2BP (LRP2 Binding Protein (LRP2BP))

Reaktivität: Human, Ratte, Hund, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRP2BP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRP2BP Antikörper

Bindungsspezifität: Middle Region

Spezifität: LRP2 BP antibody was raised against the middle region of LRP2 P

Aufreinigung: Affinity purified

Immunogen: LRP2 BP antibody was raised using the middle region of LRP2 P corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRP2BP Blocking Peptide, (ABIN5614567), is also available for use as a blocking control in assays to test for specificity of this LRP2BP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRP2BP

Target: LRP2BP (LRP2 Binding Protein (LRP2BP))

Andere Bezeichnung: LRP2BP

Hintergrund: LRP2BP may act as an adapter that regulates LRP2 function.

Molekulargewicht: 38 kDa (MW of target protein)