SPATA16 Antikörper (N-Term)

Produktnummer ABIN632429

Produktdetails anti-SPATA16 Antikörper

Target: SPATA16 (Spermatogenesis Associated 16 (SPATA16))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPATA16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPATA16 antibody was raised against the N terminal of SPATA16

Aufreinigung: Affinity purified

Immunogen: SPATA16 antibody was raised using the N terminal of SPATA16 corresponding to a region with amino acids MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPATA16 Blocking Peptide, catalog no. 33R-5820, is also available for use as a blocking control in assays to test for specificity of this SPATA16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPATA16

Target: SPATA16 (Spermatogenesis Associated 16 (SPATA16))

Andere Bezeichnung: SPATA16 (SPATA16 Produkte)

Synonyme: RGD1563726 antikoerper, NYD-SP12 antikoerper, SPGF6 antikoerper, 4921511F01Rik antikoerper, 4930503K02Rik antikoerper, Nyd-sp12 antikoerper, spermatogenesis associated 16 antikoerper, Spata16 antikoerper, SPATA16 antikoerper

Hintergrund: SPATA16 is involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion. Defects in SPATA16 are a cause of globozoospermia, also called Round-headed spermatozoa.

Molekulargewicht: 63 kDa (MW of target protein)