GLRX5 Antikörper (Middle Region)
-
- Target Alle GLRX5 Antikörper anzeigen
- GLRX5 (Glutaredoxin 5 (GLRX5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GLRX5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GLRX5 antibody was raised against the middle region of GLRX5
- Aufreinigung
- Affinity purified
- Immunogen
- GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG
- Top Product
- Discover our top product GLRX5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLRX5 Blocking Peptide, catalog no. 33R-6648, is also available for use as a blocking control in assays to test for specificity of this GLRX5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLRX5 (Glutaredoxin 5 (GLRX5))
- Andere Bezeichnung
- GLRX5 (GLRX5 Produkte)
- Synonyme
- grx5 antikoerper, C14orf87 antikoerper, FLB4739 antikoerper, GRX5 antikoerper, PR01238 antikoerper, PRO1238 antikoerper, RGD1308383 antikoerper, 2310004O13Rik antikoerper, 2900070E19Rik antikoerper, AU020725 antikoerper, id:ibd5119 antikoerper, wu:fa09g08 antikoerper, zgc:73343 antikoerper, glutaredoxin 5 L homeolog antikoerper, glutaredoxin 5 antikoerper, glutaredoxin 5 homolog (S. cerevisiae) antikoerper, glrx5.L antikoerper, GLRX5 antikoerper, Glrx5 antikoerper, glrx5 antikoerper
- Hintergrund
- Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.
- Molekulargewicht
- 16 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-