KLHL7 Antikörper

Produktnummer ABIN632426

Der Kaninchen Polyklonal Anti-KLHL7-Antikörper wurde für WB validiert. Er ist geeignet, KLHL7 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für KLHL7 Antikörper (ABIN632426)

Target: KLHL7 (Kelch-Like 7 (KLHL7))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHL7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KLHL7 Antikörper

Aufreinigung: Affinity purified

Immunogen: KLHL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHL7 Blocking Peptide, (ABIN936983), is also available for use as a blocking control in assays to test for specificity of this KLHL7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHL7

Target: KLHL7 (Kelch-Like 7 (KLHL7))

Andere Bezeichnung: KLHL7

Hintergrund: Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.

Molekulargewicht: 62 kDa (MW of target protein)