EPB41 Antikörper

Produktnummer ABIN632418

Der Kaninchen Polyklonal anti-EPB41 Antikörper (ABIN632418) detektiert spezifisch EPB41 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für EPB41 Antikörper (ABIN632418)

Target: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPB41 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EPB41 Antikörper

Aufreinigung: Affinity purified

Immunogen: EPB41 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPB41 Blocking Peptide, (ABIN5613381), is also available for use as a blocking control in assays to test for specificity of this EPB41 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB41 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPB41

Target: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Andere Bezeichnung: EPB41

Hintergrund: Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia.

Molekulargewicht: 66 kDa (MW of target protein)