LIN37 Antikörper (Lin-37 Homolog (C. Elegans))

Details for Product anti-LIN37 Antibody No. ABIN632413
Antigen
Reaktivität
Human
7
3
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
7
Klonalität
Polyklonal
Konjugat
Dieser LIN37 Antikörper ist unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
4
3
1
Optionen
Immunogen LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
Reinigung Affinity purified
Antigen
Andere Bezeichnung LIN37 (LIN37 Antibody Abstract)
Hintergrund This gene encodes a protein expressed in the eye.
Molekulargewicht 28 kDa (MW of target protein)
Pathways Zellzyklus, Mitotic G1-G1/S Phases
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

LIN37 Blocking Peptide, catalog no. 33R-3828, is also available for use as a blocking control in assays to test for specificity of this LIN37 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN37 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Lin-37 Homolog (C. Elegans) (LIN37) antibody (ABIN632413) LIN37 antibody used at 1 ug/ml to detect target protein.