LIN37 Antikörper

Produktnummer ABIN632413

Produktdetails anti-LIN37 Antikörper

Target: LIN37 (Lin-37 Homolog (LIN37))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIN37 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIN37 Blocking Peptide, catalog no. 33R-3828, is also available for use as a blocking control in assays to test for specificity of this LIN37 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN37 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIN37

Target: LIN37 (Lin-37 Homolog (LIN37))

Andere Bezeichnung: LIN37 (LIN37 Produkte)

Synonyme: F25965 antikoerper, ZK418.4 antikoerper, lin-37 antikoerper, 1810054G18Rik antikoerper, lin-37 DREAM MuvB core complex component antikoerper, lin-37 homolog (C. elegans) antikoerper, LIN37 antikoerper, Lin37 antikoerper

Hintergrund: This gene encodes a protein expressed in the eye.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Zellzyklus, Mitotic G1-G1/S Phases