OSGEP Antikörper (N-Term)

Produktnummer ABIN632411

Produktdetails anti-OSGEP Antikörper

Target: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OSGEP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OSGEP antibody was raised against the N terminal of OSGEP

Aufreinigung: Affinity purified

Immunogen: OSGEP antibody was raised using the N terminal of OSGEP corresponding to a region with amino acids PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSGEP Blocking Peptide, catalog no. 33R-7254, is also available for use as a blocking control in assays to test for specificity of this OSGEP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGEP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OSGEP

Target: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Andere Bezeichnung: OSGEP (OSGEP Produkte)

Synonyme: MGC64557 antikoerper, wu:fj38e02 antikoerper, zgc:112527 antikoerper, si:ch211-214j24.11 antikoerper, Afu6g04510 antikoerper, Tb07.33N13.430 antikoerper, GCPL1 antikoerper, KAE1 antikoerper, OSGEP1 antikoerper, PRSMG1 antikoerper, 1500019L24Rik antikoerper, GCPL-1 antikoerper, O-sialoglycoprotein endopeptidase L homeolog antikoerper, O-sialoglycoprotein endopeptidase antikoerper, o-sialoglycoprotein endopeptidase antikoerper, osgep.L antikoerper, OSGEP antikoerper, osgep antikoerper, CNA03390 antikoerper, AFUA_6G04510 antikoerper, Tc00.1047053508913.39 antikoerper, Tc00.1047053506515.20 antikoerper, Tb927.7.6470 antikoerper, PVX_111195 antikoerper, AaeL_AAEL001942 antikoerper, GL50803_17420 antikoerper, EDI_342200 antikoerper, CC1G_03622 antikoerper, THAPSDRAFT_2332 antikoerper, TTHERM_00442549 antikoerper, Osgep antikoerper, LOC100273984 antikoerper

Hintergrund: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Molekulargewicht: 36 kDa (MW of target protein)