SH3GL1 Antikörper (N-Term)

Produktnummer ABIN632409

Dieses Anti-SH3GL1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SH3GL1 in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für SH3GL1 Antikörper (N-Term) (ABIN632409)

Target: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3GL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SH3GL1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SH3 GL1 antibody was raised against the N terminal of SH3 L1

Aufreinigung: Affinity purified

Immunogen: SH3 GL1 antibody was raised using the N terminal of SH3 L1 corresponding to a region with amino acids LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3GL1 Blocking Peptide, (ABIN5616126), is also available for use as a blocking control in assays to test for specificity of this SH3GL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3GL1

Target: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Andere Bezeichnung: SH3GL1

Hintergrund: SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Molekulargewicht: 41 kDa (MW of target protein)