COPG2 Antikörper (N-Term)

Produktnummer ABIN632404

Produktdetails anti-COPG2 Antikörper

Target: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COPG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: COPG2 antibody was raised against the N terminal of COPG2

Aufreinigung: Affinity purified

Immunogen: COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COPG2 Blocking Peptide, catalog no. 33R-6111, is also available for use as a blocking control in assays to test for specificity of this COPG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COPG2

Target: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Andere Bezeichnung: COPG2 (COPG2 Produkte)

Synonyme: 2-COP antikoerper, cb943 antikoerper, copg antikoerper, fi31b06 antikoerper, wu:fi31b06 antikoerper, AW227625 antikoerper, gamma-2-COP antikoerper, COPG antikoerper, COPG2 antikoerper, MGC83366 antikoerper, MGC79509 antikoerper, RGD1566215 antikoerper, coatomer protein complex subunit gamma 2 antikoerper, coatomer protein complex, subunit gamma 2 antikoerper, coatomer protein complex subunit gamma 1 antikoerper, coatomer protein complex subunit gamma 2 S homeolog antikoerper, coatomer subunit gamma-2 antikoerper, COPG2 antikoerper, copg2 antikoerper, Copg2 antikoerper, COPG1 antikoerper, copg2.S antikoerper, LOC100068740 antikoerper, LOC100560095 antikoerper, LOC100594709 antikoerper

Hintergrund: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Molekulargewicht: 97 kDa (MW of target protein)