COPG2 Antikörper (N-Term)

Produktnummer ABIN632404

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch COPG2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für COPG2 Antikörper (N-Term) (ABIN632404)

Target: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COPG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-COPG2 Antikörper

Bindungsspezifität: N-Term

Spezifität: COPG2 antibody was raised against the N terminal of COPG2

Aufreinigung: Affinity purified

Immunogen: COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COPG2 Blocking Peptide, (ABIN5612963), is also available for use as a blocking control in assays to test for specificity of this COPG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COPG2

Target: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Andere Bezeichnung: COPG2

Hintergrund: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Molekulargewicht: 97 kDa (MW of target protein)