ICA1 Antikörper (C-Term)

Produktnummer ABIN632403

Dieses Anti-ICA1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ICA1 in WB. Geeignet für Human und Maus.

Kurzübersicht für ICA1 Antikörper (C-Term) (ABIN632403)

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ICA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ICA1 Antikörper

Bindungsspezifität: C-Term

Spezifität: ICA1 antibody was raised against the C terminal of ICA1

Aufreinigung: Affinity purified

Immunogen: ICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ICA1 Blocking Peptide, (ABIN5614123), is also available for use as a blocking control in assays to test for specificity of this ICA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ICA1

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Andere Bezeichnung: ICA1

Hintergrund: ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome.

Molekulargewicht: 53 kDa (MW of target protein)