TTC23L Antikörper (N-Term)

Produktnummer ABIN632401

Produktdetails anti-TTC23L Antikörper

Target: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTC23L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FLJ25439 antibody was raised against the N terminal Of Flj25439

Aufreinigung: Affinity purified

Immunogen: FLJ25439 antibody was raised using the N terminal Of Flj25439 corresponding to a region with amino acids MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ25439 Blocking Peptide, catalog no. 33R-6319, is also available for use as a blocking control in assays to test for specificity of this FLJ25439 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25439 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTC23L

Target: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Abstract: TTC23L Produkte

Synonyme: RGD1564928 antikoerper, MC25-1 antikoerper, 4930401A09Rik antikoerper, tetratricopeptide repeat domain 23 like antikoerper, tetratricopeptide repeat domain 23-like antikoerper, TTC23L antikoerper, Ttc23l antikoerper, ttc23l antikoerper

Hintergrund: The function of FLJ25439 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 41 kDa (MW of target protein)