TTC23L Antikörper (N-Term)

Produktnummer ABIN632401

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TTC23L in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für TTC23L Antikörper (N-Term) (ABIN632401)

Target: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTC23L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TTC23L Antikörper

Bindungsspezifität: N-Term

Spezifität: FLJ25439 antibody was raised against the N terminal Of Flj25439

Aufreinigung: Affinity purified

Immunogen: FLJ25439 antibody was raised using the N terminal Of Flj25439 corresponding to a region with amino acids MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ25439 Blocking Peptide, (ABIN5613609), is also available for use as a blocking control in assays to test for specificity of this FLJ25439 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25439 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTC23L

Target: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Hintergrund: The function of FLJ25439 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 41 kDa (MW of target protein)