gamma 1 Adaptin Antikörper (C-Term)

Produktnummer ABIN632398

Produktdetails anti-gamma 1 Adaptin Antikörper

Target: gamma 1 Adaptin (AP1G1) (Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser gamma 1 Adaptin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AP1 G1 antibody was raised against the C terminal of AP1 1

Aufreinigung: Affinity purified

Immunogen: AP1 G1 antibody was raised using the C terminal of AP1 1 corresponding to a region with amino acids DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AP1G1 Blocking Peptide, catalog no. 33R-1979, is also available for use as a blocking control in assays to test for specificity of this AP1G1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu gamma 1 Adaptin

Target: gamma 1 Adaptin (AP1G1) (Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1))

Andere Bezeichnung: AP1G1 (AP1G1 Produkte)

Synonyme: ADTG antikoerper, CLAPG1 antikoerper, AA409002 antikoerper, AU041323 antikoerper, AW551707 antikoerper, Adtg antikoerper, D8Ertd374e antikoerper, adtg antikoerper, wu:fc30a11 antikoerper, zgc:56079 antikoerper, AP1G1 antikoerper, adaptor related protein complex 1 gamma 1 subunit antikoerper, AP-1 complex subunit gamma-1 antikoerper, AP-1 adaptor complex gamma subunit Apl4 antikoerper, hypothetical protein antikoerper, adaptor protein complex AP-1, gamma 1 subunit antikoerper, adaptor-related protein complex 1, gamma 1 subunit antikoerper, adaptor related protein complex 1 gamma 1 subunit L homeolog antikoerper, gamma-adaptin antikoerper, AP1G1 antikoerper, NCU04121 antikoerper, PTRG_00081 antikoerper, SJAG_01809 antikoerper, UREG_02085 antikoerper, BDBG_07402 antikoerper, PAAG_11376 antikoerper, MCYG_00840 antikoerper, PITG_11143 antikoerper, VDBG_09354 antikoerper, Ap1g1 antikoerper, ap1g1 antikoerper, ap1g1.L antikoerper, ANI_1_330014 antikoerper, AOR_1_802184 antikoerper, MGYG_01130 antikoerper, EDI_324200 antikoerper, TERG_00390 antikoerper, Tsp_09544 antikoerper

Hintergrund: Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.

Molekulargewicht: 91 kDa (MW of target protein)