VPS52 Antikörper

Produktnummer ABIN632392

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch VPS52 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für VPS52 Antikörper (ABIN632392)

Target: VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPS52 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VPS52 Antikörper

Aufreinigung: Affinity purified

Immunogen: VPS52 antibody was raised using a synthetic peptide corresponding to a region with amino acids RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPS52 Blocking Peptide, (ABIN5616981), is also available for use as a blocking control in assays to test for specificity of this VPS52 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS52 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPS52

Target: VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))

Andere Bezeichnung: VPS52

Hintergrund: This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.

Molekulargewicht: 82 kDa (MW of target protein)