NECAP2 Antikörper (N-Term)

Produktnummer ABIN632387

Produktdetails anti-NECAP2 Antikörper

Target: NECAP2 (NECAP Endocytosis Associated 2 (NECAP2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NECAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NECAP2 antibody was raised against the N terminal of NECAP2

Aufreinigung: Affinity purified

Immunogen: NECAP2 antibody was raised using the N terminal of NECAP2 corresponding to a region with amino acids WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NECAP2 Blocking Peptide, catalog no. 33R-9994, is also available for use as a blocking control in assays to test for specificity of this NECAP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NECAP2

Target: NECAP2 (NECAP Endocytosis Associated 2 (NECAP2))

Andere Bezeichnung: NECAP2 (NECAP2 Produkte)

Synonyme: MGC83534 antikoerper, 1110005F07Rik antikoerper, AA409105 antikoerper, C78898 antikoerper, NECAP endocytosis associated 2 antikoerper, NECAP endocytosis associated 2 L homeolog antikoerper, NECAP2 antikoerper, necap2.L antikoerper, necap2 antikoerper, Necap2 antikoerper

Hintergrund: This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.

Molekulargewicht: 28 kDa (MW of target protein)