NECAP2 Antikörper (N-Term)
-
- Target Alle NECAP2 Antikörper anzeigen
- NECAP2 (NECAP Endocytosis Associated 2 (NECAP2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NECAP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NECAP2 antibody was raised against the N terminal of NECAP2
- Aufreinigung
- Affinity purified
- Immunogen
- NECAP2 antibody was raised using the N terminal of NECAP2 corresponding to a region with amino acids WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV
- Top Product
- Discover our top product NECAP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NECAP2 Blocking Peptide, catalog no. 33R-9994, is also available for use as a blocking control in assays to test for specificity of this NECAP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NECAP2 (NECAP Endocytosis Associated 2 (NECAP2))
- Andere Bezeichnung
- NECAP2 (NECAP2 Produkte)
- Hintergrund
- This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.
- Molekulargewicht
- 28 kDa (MW of target protein)
-