LYSMD1 Antikörper (N-Term)

Produktnummer ABIN632386

Produktdetails anti-LYSMD1 Antikörper

Target: LYSMD1 (LysM, Putative Peptidoglycan-Binding, Domain Containing 1 (LYSMD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYSMD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LYSMD1 antibody was raised against the N terminal of LYSMD1

Aufreinigung: Affinity purified

Immunogen: LYSMD1 antibody was raised using the N terminal of LYSMD1 corresponding to a region with amino acids VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYSMD1 Blocking Peptide, catalog no. 33R-9771, is also available for use as a blocking control in assays to test for specificity of this LYSMD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYSMD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYSMD1

Target: LYSMD1 (LysM, Putative Peptidoglycan-Binding, Domain Containing 1 (LYSMD1))

Andere Bezeichnung: LYSMD1 (LYSMD1 Produkte)

Synonyme: zgc:153301 antikoerper, LYSMD1 antikoerper, RP11-68I18.5 antikoerper, 2610022K04Rik antikoerper, AI415311 antikoerper, LysM domain containing 1 antikoerper, LysM, putative peptidoglycan-binding, domain containing 1 antikoerper, LysM, putative peptidoglycan-binding, domain containing 1 S homeolog antikoerper, LYSMD1 antikoerper, lysmd1 antikoerper, lysmd1.S antikoerper, Lysmd1 antikoerper

Hintergrund: The function of LYSMD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 25 kDa (MW of target protein)