Amphiphysin Antikörper (N-Term)

Produktnummer ABIN632382

Produktdetails anti-Amphiphysin Antikörper

Target: Amphiphysin (AMPH)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Amphiphysin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Amphiphysin antibody was raised against the N terminal of AMPH

Aufreinigung: Affinity purified

Immunogen: Amphiphysin antibody was raised using the N terminal of AMPH corresponding to a region with amino acids ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Amphiphysin Blocking Peptide, catalog no. 33R-1095, is also available for use as a blocking control in assays to test for specificity of this Amphiphysin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMPH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Amphiphysin

Target: Amphiphysin (AMPH)

Andere Bezeichnung: Amphiphysin (AMPH Produkte)

Synonyme: Amp antikoerper, CG8604 antikoerper, DAMP antikoerper, Damp antikoerper, Dmel\\CG8604 antikoerper, amph antikoerper, dAmph antikoerper, damph antikoerper, AMPH antikoerper, Amph antikoerper, GB16263 antikoerper, AMPH1 antikoerper, Amph1 antikoerper, wu:fq25h04 antikoerper, zgc:73193 antikoerper, amphiphysin antikoerper, Amphiphysin antikoerper, amphiphysin L homeolog antikoerper, AMPH antikoerper, Amph antikoerper, amph antikoerper, LOC409851 antikoerper, amph.L antikoerper, LOC100343468 antikoerper

Hintergrund: AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.

Molekulargewicht: 76 kDa (MW of target protein)