Desmin Antikörper (Middle Region)

Produktnummer ABIN632380

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Desmin in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte, Maus und Hund.

Kurzübersicht für Desmin Antikörper (Middle Region) (ABIN632380)

Target: Desmin (DES)

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Desmin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Desmin Antikörper

Bindungsspezifität: Middle Region

Spezifität: Desmin antibody was raised against the middle region of DES

Aufreinigung: Affinity purified

Immunogen: Desmin antibody was raised using the middle region of DES corresponding to a region with amino acids MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Desmin Blocking Peptide, (ABIN5613180), is also available for use as a blocking control in assays to test for specificity of this Desmin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Desmin

Target: Desmin (DES)

Andere Bezeichnung: Desmin

Hintergrund: DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Molekulargewicht: 53 kDa (MW of target protein)