ARL17 Antikörper (Middle Region)
-
- Target Alle ARL17 Antikörper anzeigen
- ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))
- Bindungsspezifität
- Middle Region
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARL17 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- ARL17 antibody was raised against the middle region of ARL17
- Aufreinigung
- Affinity purified
- Immunogen
- ARL17 antibody was raised using the middle region of ARL17 corresponding to a region with amino acids KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD
- Top Product
- Discover our top product ARL17 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARL17 Blocking Peptide, catalog no. 33R-4276, is also available for use as a blocking control in assays to test for specificity of this ARL17 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL17 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))
- Andere Bezeichnung
- ARL17 (ARL17 Produkte)
- Synonyme
- ARL17 antikoerper, ARL17A antikoerper, ADP ribosylation factor like GTPase 17B antikoerper, ARL17B antikoerper
- Hintergrund
- ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus.
- Molekulargewicht
- 19 kDa (MW of target protein)
-