ARL17 Antikörper (Middle Region)

Produktnummer ABIN632378

Der Kaninchen Polyklonal Anti-ARL17-Antikörper wurde für WB validiert. Er ist geeignet, ARL17 in Proben von Human zu detektieren.

Kurzübersicht für ARL17 Antikörper (Middle Region) (ABIN632378)

Target: ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARL17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ARL17 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ARL17 antibody was raised against the middle region of ARL17

Aufreinigung: Affinity purified

Immunogen: ARL17 antibody was raised using the middle region of ARL17 corresponding to a region with amino acids KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARL17 Blocking Peptide, (ABIN939662), is also available for use as a blocking control in assays to test for specificity of this ARL17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARL17

Target: ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))

Andere Bezeichnung: ARL17

Hintergrund: ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus.

Molekulargewicht: 19 kDa (MW of target protein)