GFOD1 Antikörper (Middle Region)

Produktnummer ABIN632377

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GFOD1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für GFOD1 Antikörper (Middle Region) (ABIN632377)

Target: GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1 (GFOD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GFOD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GFOD1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GFOD1 antibody was raised against the middle region of GFOD1

Aufreinigung: Affinity purified

Immunogen: GFOD1 antibody was raised using the middle region of GFOD1 corresponding to a region with amino acids NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GFOD1 Blocking Peptide, (ABIN5613751), is also available for use as a blocking control in assays to test for specificity of this GFOD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFOD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GFOD1

Target: GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1 (GFOD1))

Andere Bezeichnung: GFOD1

Hintergrund: The function of GFOD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 43 kDa (MW of target protein)