OTUB1 Antikörper (N-Term)

Produktnummer ABIN632375

Produktdetails anti-OTUB1 Antikörper

Target: OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OTUB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OTUB1 antibody was raised against the N terminal of OTUB1

Aufreinigung: Affinity purified

Immunogen: OTUB1 antibody was raised using the N terminal of OTUB1 corresponding to a region with amino acids DRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OTUB1 Blocking Peptide, catalog no. 33R-2145, is also available for use as a blocking control in assays to test for specificity of this OTUB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OTUB1

Target: OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))

Andere Bezeichnung: OTUB1 (OTUB1 Produkte)

Synonyme: OTB1 antikoerper, OTU1 antikoerper, AI850305 antikoerper, fa19h07 antikoerper, otub1 antikoerper, wu:fa19h07 antikoerper, zgc:92839 antikoerper, MGC131231 antikoerper, fb17f04 antikoerper, otub1l antikoerper, wu:fb17f04 antikoerper, zgc:92685 antikoerper, OTU deubiquitinase, ubiquitin aldehyde binding 1 antikoerper, OTU domain, ubiquitin aldehyde binding 1 antikoerper, OTU deubiquitinase, ubiquitin aldehyde binding 1b antikoerper, OTU deubiquitinase, ubiquitin aldehyde binding 1 L homeolog antikoerper, similar to HSPC263 antikoerper, OTU deubiquitinase, ubiquitin aldehyde binding 1a antikoerper, OTUB1 antikoerper, Otub1 antikoerper, otub1b antikoerper, otub1.L antikoerper, otub1 antikoerper, RGD1565010 antikoerper, otub1a antikoerper

Hintergrund: The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin.

Molekulargewicht: 31 kDa (MW of target protein)