OTUB1 Antikörper (N-Term)
-
- Target Alle OTUB1 Antikörper anzeigen
- OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OTUB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OTUB1 antibody was raised against the N terminal of OTUB1
- Aufreinigung
- Affinity purified
- Immunogen
- OTUB1 antibody was raised using the N terminal of OTUB1 corresponding to a region with amino acids DRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRK
- Top Product
- Discover our top product OTUB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OTUB1 Blocking Peptide, catalog no. 33R-2145, is also available for use as a blocking control in assays to test for specificity of this OTUB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))
- Andere Bezeichnung
- OTUB1 (OTUB1 Produkte)
- Synonyme
- OTB1 antikoerper, OTU1 antikoerper, AI850305 antikoerper, fa19h07 antikoerper, otub1 antikoerper, wu:fa19h07 antikoerper, zgc:92839 antikoerper, MGC131231 antikoerper, fb17f04 antikoerper, otub1l antikoerper, wu:fb17f04 antikoerper, zgc:92685 antikoerper, OTU deubiquitinase, ubiquitin aldehyde binding 1 antikoerper, OTU domain, ubiquitin aldehyde binding 1 antikoerper, OTU deubiquitinase, ubiquitin aldehyde binding 1b antikoerper, OTU deubiquitinase, ubiquitin aldehyde binding 1 L homeolog antikoerper, similar to HSPC263 antikoerper, OTU deubiquitinase, ubiquitin aldehyde binding 1a antikoerper, OTUB1 antikoerper, Otub1 antikoerper, otub1b antikoerper, otub1.L antikoerper, otub1 antikoerper, RGD1565010 antikoerper, otub1a antikoerper
- Hintergrund
- The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin.
- Molekulargewicht
- 31 kDa (MW of target protein)
-