OTUB1 Antikörper (N-Term)

Produktnummer ABIN632375

Der Kaninchen Polyklonal Anti-OTUB1 Antikörper wurde für WB validiert. Er ist geeignet, OTUB1 in Proben von Human zu detektieren.

Kurzübersicht für OTUB1 Antikörper (N-Term) (ABIN632375)

Target: OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OTUB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OTUB1 Antikörper

Bindungsspezifität: N-Term

Spezifität: OTUB1 antibody was raised against the N terminal of OTUB1

Aufreinigung: Affinity purified

Immunogen: OTUB1 antibody was raised using the N terminal of OTUB1 corresponding to a region with amino acids DRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OTUB1 Blocking Peptide, (ABIN937531), is also available for use as a blocking control in assays to test for specificity of this OTUB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OTUB1

Target: OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))

Andere Bezeichnung: OTUB1

Hintergrund: The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin.

Molekulargewicht: 31 kDa (MW of target protein)