HAUS7 Antikörper (Middle Region)

Produktnummer ABIN632374

Produktdetails anti-HAUS7 Antikörper

Target: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAUS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UCHL5 IP antibody was raised against the middle region of UCHL5 P

Aufreinigung: Affinity purified

Immunogen: UCHL5 IP antibody was raised using the middle region of UCHL5 P corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UCHL5IP Blocking Peptide, catalog no. 33R-5125, is also available for use as a blocking control in assays to test for specificity of this UCHL5IP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAUS7

Target: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Andere Bezeichnung: UCHL5IP (HAUS7 Produkte)

Synonyme: UCHL5IP antikoerper, UIP1 antikoerper, 1110020L19Rik antikoerper, Uchl5ip antikoerper, Uip1 antikoerper, RGD1562991 antikoerper, HAUS augmin like complex subunit 7 antikoerper, HAUS augmin-like complex, subunit 7 antikoerper, HAUS7 antikoerper, Haus7 antikoerper

Hintergrund: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Molekulargewicht: 47 kDa (MW of target protein)