HAUS7 Antikörper (Middle Region)

Produktnummer ABIN632374

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HAUS7 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für HAUS7 Antikörper (Middle Region) (ABIN632374)

Target: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAUS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HAUS7 Antikörper

Bindungsspezifität: Middle Region

Spezifität: UCHL5 IP antibody was raised against the middle region of UCHL5 P

Aufreinigung: Affinity purified

Immunogen: UCHL5 IP antibody was raised using the middle region of UCHL5 P corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UCHL5IP Blocking Peptide, (ABIN940511), is also available for use as a blocking control in assays to test for specificity of this UCHL5IP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAUS7

Target: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Andere Bezeichnung: UCHL5IP

Hintergrund: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Molekulargewicht: 47 kDa (MW of target protein)