PFKFB4 Antikörper (N-Term)

Produktnummer ABIN632373

Dieses Anti-PFKFB4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PFKFB4 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PFKFB4 Antikörper (N-Term) (ABIN632373)

Target: PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PFKFB4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PFKFB4 Antikörper

Bindungsspezifität: N-Term

Spezifität: PFKFB4 antibody was raised against the N terminal of PFKFB4

Aufreinigung: Affinity purified

Immunogen: PFKFB4 antibody was raised using the N terminal of PFKFB4 corresponding to a region with amino acids MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PFKFB4 Blocking Peptide, (ABIN5615325), is also available for use as a blocking control in assays to test for specificity of this PFKFB4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKFB4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PFKFB4

Target: PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))

Andere Bezeichnung: PFKFB4

Hintergrund: PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.

Molekulargewicht: 54 kDa (MW of target protein)