FBXO33 Antikörper (Middle Region)

Produktnummer ABIN632372

Produktdetails anti-FBXO33 Antikörper

Target: FBXO33 (F-Box Protein 33 (FBXO33))

Bindungsspezifität: Middle Region

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO33 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXO33 antibody was raised against the middle region of FBXO33

Aufreinigung: Affinity purified

Immunogen: FBXO33 antibody was raised using the middle region of FBXO33 corresponding to a region with amino acids VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO33 Blocking Peptide, catalog no. 33R-9590, is also available for use as a blocking control in assays to test for specificity of this FBXO33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO33

Target: FBXO33 (F-Box Protein 33 (FBXO33))

Andere Bezeichnung: FBXO33 (FBXO33 Produkte)

Synonyme: FBXO33 antikoerper, BMND12 antikoerper, Fbx33 antikoerper, c14_5247 antikoerper, 5730501N20Rik antikoerper, AI642135 antikoerper, F-box protein 33 antikoerper, F-box protein 33 S homeolog antikoerper, FBXO33 antikoerper, fbxo33 antikoerper, fbxo33.S antikoerper, Fbxo33 antikoerper

Hintergrund: FBXO33 is the substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO33 probably recognises and binds to phosphorylated target proteins. recognises YBX1.

Molekulargewicht: 62 kDa (MW of target protein)