SENP5 Antikörper (Middle Region)

Produktnummer ABIN632368

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SENP5 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SENP5 Antikörper (Middle Region) (ABIN632368)

Target: SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SENP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SENP5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SENP5 antibody was raised against the middle region of SENP5

Aufreinigung: Affinity purified

Immunogen: SENP5 antibody was raised using the middle region of SENP5 corresponding to a region with amino acids LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SENP5 Blocking Peptide, (ABIN5616044), is also available for use as a blocking control in assays to test for specificity of this SENP5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SENP5

Target: SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))

Andere Bezeichnung: SENP5

Hintergrund: The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.

Molekulargewicht: 87 kDa (MW of target protein)