Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) Antikörper
-
- Target Alle Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) Antikörper anzeigen
- Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRC51 antibody was raised against the N terminal of LRRC51
- Aufreinigung
- Affinity purified
- Immunogen
- LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL
- Top Product
- Discover our top product LRTOMT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRC51 Blocking Peptide, catalog no. 33R-6248, is also available for use as a blocking control in assays to test for specificity of this LRRC51 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC51 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)
- Andere Bezeichnung
- LRRC51 (LRTOMT Produkte)
- Synonyme
- DFNB63 antikoerper, LRRC51 antikoerper, Lrtomt antikoerper, RGD1561509 antikoerper, lrrp51 antikoerper, lrtomt antikoerper, zgc:153736 antikoerper, leucine rich transmembrane and O-methyltransferase domain containing antikoerper, leucine-rich repeat-containing protein 51 antikoerper, leucine rich repeat containing 51 antikoerper, LRTOMT antikoerper, LRRC51 antikoerper, Lrtomt antikoerper, lrrc51 antikoerper
- Hintergrund
- LRRC51 encodes two different proteins. One is a leucine-rich transmembrane protein of unknown function while the other is an O-methyltransferase. Defects in the O-methyltransferase protein can cause nonsyndromic deafness. Several transcript variants encoding different isoforms of each protein have been found for this gene, along with a transcript that is not thought to be protein-coding.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-