Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) Antikörper

Produktnummer ABIN632367

Dieses Anti--Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von in WB. Geeignet für Human.

Kurzübersicht für Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) Antikörper (ABIN632367)

Target: Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: LRRC51 antibody was raised against the N terminal of LRRC51

Aufreinigung: Affinity purified

Immunogen: LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC51 Blocking Peptide, (ABIN5614579), is also available for use as a blocking control in assays to test for specificity of this LRRC51 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC51 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)

Andere Bezeichnung: LRRC51

Hintergrund: LRRC51 encodes two different proteins. One is a leucine-rich transmembrane protein of unknown function while the other is an O-methyltransferase. Defects in the O-methyltransferase protein can cause nonsyndromic deafness. Several transcript variants encoding different isoforms of each protein have been found for this gene, along with a transcript that is not thought to be protein-coding.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Sensory Perception of Sound