UFL1 Antikörper (Middle Region)

Produktnummer ABIN632366

Der Kaninchen Polyklonal Anti-UFL1-Antikörper wurde für WB validiert. Er ist geeignet, UFL1 in Proben von Human zu detektieren.

Kurzübersicht für UFL1 Antikörper (Middle Region) (ABIN632366)

Target: UFL1 (UFM1-Specific Ligase 1 (UFL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UFL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UFL1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KIAA0776 antibody was raised against the middle region of KIAA0776

Aufreinigung: Affinity purified

Immunogen: KIAA0776 antibody was raised using the middle region of KIAA0776 corresponding to a region with amino acids EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0776 Blocking Peptide, catalog no. 33R-2824, is also available for use as a blocking control in assays to test for specificity of this KIAA0776 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0776 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UFL1

Target: UFL1 (UFM1-Specific Ligase 1 (UFL1))

Andere Bezeichnung: KIAA0776

Hintergrund: KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.

Molekulargewicht: 89 kDa (MW of target protein)