FLJ33790 (N-Term) Antikörper

Produktnummer ABIN632361

Der Kaninchen Polyklonal anti-FLJ33790 Antikörper (ABIN632361) detektiert spezifisch FLJ33790 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für FLJ33790 (N-Term) Antikörper (ABIN632361)

Target: FLJ33790

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: FLJ33790 antibody was raised against the N terminal of FLJ33790

Aufreinigung: Affinity purified

Immunogen: FLJ33790 antibody was raised using the N terminal of FLJ33790 corresponding to a region with amino acids RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ33790 Blocking Peptide, (ABIN5613612), is also available for use as a blocking control in assays to test for specificity of this FLJ33790 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ33790 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: FLJ33790

Hintergrund: The function of FLJ33790 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 40 kDa (MW of target protein)