DENND2C Antikörper (Middle Region)

Produktnummer ABIN632358

Produktdetails anti-DENND2C Antikörper

Target: DENND2C (DENN/MADD Domain Containing 2C (DENND2C))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DENND2C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DENND2 C antibody was raised against the middle region of DENND2

Aufreinigung: Affinity purified

Immunogen: DENND2 C antibody was raised using the middle region of DENND2 corresponding to a region with amino acids DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DENND2C Blocking Peptide, catalog no. 33R-1994, is also available for use as a blocking control in assays to test for specificity of this DENND2C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DENND2C

Target: DENND2C (DENN/MADD Domain Containing 2C (DENND2C))

Andere Bezeichnung: DENND2C (DENND2C Produkte)

Synonyme: si:dkeyp-46c9.6 antikoerper, MGC145874 antikoerper, dJ1156J9.1 antikoerper, A930010I20Rik antikoerper, RGD1308197 antikoerper, DENN domain containing 2C antikoerper, DENN/MADD domain containing 2C antikoerper, DENND2C antikoerper, dennd2c antikoerper, Dennd2c antikoerper

Hintergrund: The specific function of DENND2C is not yet known.

Molekulargewicht: 100 kDa (MW of target protein)