FBXO36 Antikörper (N-Term)

Produktnummer ABIN632357

Der Kaninchen Polyklonal Anti-FBXO36-Antikörper wurde für WB validiert. Er ist geeignet, FBXO36 in Proben von Human zu detektieren.

Kurzübersicht für FBXO36 Antikörper (N-Term) (ABIN632357)

Target: FBXO36 (F-Box Protein 36 (FBXO36))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO36 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBXO36 Antikörper

Bindungsspezifität: N-Term

Spezifität: FBXO36 antibody was raised against the N terminal of FBXO36

Aufreinigung: Affinity purified

Immunogen: FBXO36 antibody was raised using the N terminal of FBXO36 corresponding to a region with amino acids QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO36 Blocking Peptide, (ABIN5613547), is also available for use as a blocking control in assays to test for specificity of this FBXO36 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO36 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO36

Target: FBXO36 (F-Box Protein 36 (FBXO36))

Andere Bezeichnung: FBXO36

Hintergrund: Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molekulargewicht: 22 kDa (MW of target protein)