FBXO16 Antikörper (N-Term)

Produktnummer ABIN632355

Produktdetails anti-FBXO16 Antikörper

Target: FBXO16 (F-Box Protein 16 (FBXO16))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXO16 antibody was raised against the N terminal of FBXO16

Aufreinigung: Affinity purified

Immunogen: FBXO16 antibody was raised using the N terminal of FBXO16 corresponding to a region with amino acids CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO16 Blocking Peptide, catalog no. 33R-1795, is also available for use as a blocking control in assays to test for specificity of this FBXO16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO16

Target: FBXO16 (F-Box Protein 16 (FBXO16))

Andere Bezeichnung: FBXO16 (FBXO16 Produkte)

Synonyme: si:ch211-89p3.1 antikoerper, zgc:112464 antikoerper, FBX16 antikoerper, 4932435C24Rik antikoerper, Fbx16 antikoerper, F-box protein 16 antikoerper, FBXO16 antikoerper, LOC100150082 antikoerper, fbxo16 antikoerper, Fbxo16 antikoerper

Hintergrund: FBXO16 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO16 belongs to the Fbx class.

Molekulargewicht: 34 kDa (MW of target protein)