FAM76A Antikörper (Middle Region)

Produktnummer ABIN632353

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch FAM76A in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für FAM76A Antikörper (Middle Region) (ABIN632353)

Target: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM76A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM76A Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM76 A antibody was raised against the middle region of FAM76

Aufreinigung: Affinity purified

Immunogen: FAM76 A antibody was raised using the middle region of FAM76 corresponding to a region with amino acids QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM76A Blocking Peptide, (ABIN5613501), is also available for use as a blocking control in assays to test for specificity of this FAM76A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM76A

Target: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Andere Bezeichnung: FAM76A

Hintergrund: The specific function of FAM76A is not yet known.

Molekulargewicht: 35 kDa (MW of target protein)