FBXL14 Antikörper (N-Term)

Produktnummer ABIN632352

Produktdetails anti-FBXL14 Antikörper

Target: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXL14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXL14 antibody was raised against the N terminal of FBXL14

Aufreinigung: Affinity purified

Immunogen: FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXL14 Blocking Peptide, catalog no. 33R-9997, is also available for use as a blocking control in assays to test for specificity of this FBXL14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXL14

Target: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Andere Bezeichnung: FBXL14 (FBXL14 Produkte)

Synonyme: AW322056 antikoerper, Fbx14l antikoerper, Fbl14 antikoerper, Ppa antikoerper, fbl13 antikoerper, fbxl14 antikoerper, ppab antikoerper, wu:fc44g06 antikoerper, CG9952 antikoerper, Dmel\CG9952 antikoerper, FBXL14 antikoerper, I-55 antikoerper, T21F11.10 antikoerper, T21F11_10 antikoerper, PPA antikoerper, fi25d04 antikoerper, ppaa antikoerper, wu:fb34d05 antikoerper, wu:fi25d04 antikoerper, F-box and leucine-rich repeat protein 14 antikoerper, F-box and leucine rich repeat protein 14 antikoerper, F-box and leucine-rich repeat protein 14 S homeolog antikoerper, F-box and leucine-rich repeat protein 14b antikoerper, Partner of paired antikoerper, RNI-like superfamily protein antikoerper, F-box and leucine-rich repeat protein 14a antikoerper, Fbxl14 antikoerper, FBXL14 antikoerper, fbxl14.S antikoerper, fbxl14b antikoerper, Ppa antikoerper, AT1G80570 antikoerper, fbxl14a antikoerper

Hintergrund: FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

Molekulargewicht: 46 kDa (MW of target protein)