FBXL14 Antikörper (N-Term)

Produktnummer ABIN632352

Dieses Anti-FBXL14-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FBXL14 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für FBXL14 Antikörper (N-Term) (ABIN632352)

Target: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXL14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBXL14 Antikörper

Bindungsspezifität: N-Term

Spezifität: FBXL14 antibody was raised against the N terminal of FBXL14

Aufreinigung: Affinity purified

Immunogen: FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXL14 Blocking Peptide, (ABIN5613528), is also available for use as a blocking control in assays to test for specificity of this FBXL14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXL14

Target: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Andere Bezeichnung: FBXL14

Hintergrund: FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

Molekulargewicht: 46 kDa (MW of target protein)