FBXL14 Antikörper (N-Term)
Kurzübersicht für FBXL14 Antikörper (N-Term) (ABIN632352)
Target
Alle FBXL14 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- FBXL14 antibody was raised against the N terminal of FBXL14
-
Aufreinigung
- Affinity purified
-
Immunogen
- FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
FBXL14 Blocking Peptide, (ABIN5613528), is also available for use as a blocking control in assays to test for specificity of this FBXL14 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL14 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))
-
Andere Bezeichnung
- FBXL14
-
Hintergrund
- FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.
-
Molekulargewicht
- 46 kDa (MW of target protein)
Target
-